Anti-HIVEP3
Artikelnummer:
ATA-HPA005728
| Artikelname: |
Anti-HIVEP3 |
| Artikelnummer: |
ATA-HPA005728 |
| Hersteller Artikelnummer: |
HPA005728 |
| Alternativnummer: |
ATA-HPA005728-100,ATA-HPA005728-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ICC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
FLJ16752, KBP-1, KBP1, KIAA1555, KRC, Schnurri-3, SHN3, ZAS3, ZNF40C |
| human immunodeficiency virus type I enhancer binding protein 3 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.2 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
59269 |
| UniProt: |
Q5T1R4 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
SYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMHYKLGTTL |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
HIVEP3 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
Immunohistochemical staining of human rectum shows moderate nuclear and cytoplasmic positivity in glandular cells. |
|
HPA005728 |
|
HPA005728-100ul |
|
HPA005728 |
|
HPA005728 |