Anti-HIVEP3
Artikelnummer:
ATA-HPA005728
- Bilder (6)
| Artikelname: | Anti-HIVEP3 |
| Artikelnummer: | ATA-HPA005728 |
| Hersteller Artikelnummer: | HPA005728 |
| Alternativnummer: | ATA-HPA005728-100,ATA-HPA005728-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ16752, KBP-1, KBP1, KIAA1555, KRC, Schnurri-3, SHN3, ZAS3, ZNF40C |
| human immunodeficiency virus type I enhancer binding protein 3 |
| Anti-HIVEP3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 59269 |
| UniProt: | Q5T1R4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMHYKLGTTL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HIVEP3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human rectum shows moderate nuclear and cytoplasmic positivity in glandular cells. |
|
|
HPA005728 |
|
|
HPA005728-100ul |
|
|
HPA005728 |
|
|
HPA005728 |
Produktgarantie und fachkundiger Support
