Anti-RASD2
Artikelnummer:
ATA-HPA005839
- Bilder (8)
| Artikelname: | Anti-RASD2 |
| Artikelnummer: | ATA-HPA005839 |
| Hersteller Artikelnummer: | HPA005839 |
| Alternativnummer: | ATA-HPA005839-100,ATA-HPA005839-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC:4834, Rhes, TEM2 |
| RASD family, member 2 |
| Anti-RASD2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23551 |
| UniProt: | Q96D21 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RASD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human prostate and pancreas tissues using Anti-RASD2 antibody. Corresponding RASD2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and RASD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415366). |
|
|
HPA005839-100ul |
|
|
|
|
|
HPA005839-100ul |
|
|
HPA005839-100ul |
Produktgarantie und fachkundiger Support
