Anti-NIN

Artikelnummer: ATA-HPA005939
Artikelname: Anti-NIN
Artikelnummer: ATA-HPA005939
Hersteller Artikelnummer: HPA005939
Alternativnummer: ATA-HPA005939-100,ATA-HPA005939-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NIN
ninein (GSK3B interacting protein)
Anti-NIN
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 51199
UniProt: Q8N4C6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEEVEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLELEDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NIN
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & centrosome.
Immunohistochemistry analysis in human appendix and pancreas tissues using Anti-NIN antibody. Corresponding NIN RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human appendix shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA005939-100ul
HPA005939-100ul
HPA005939-100ul