Anti-HMBS Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA006114
Artikelname: Anti-HMBS Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA006114
Hersteller Artikelnummer: HPA006114
Alternativnummer: ATA-HPA006114-100,ATA-HPA006114-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PBGD, PORC, UPS
hydroxymethylbilane synthase
Anti-HMBS
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 3145
UniProt: P08397
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HMBS
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA006114
HPA006114
HPA006114