Anti-HMBS Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA006114
| Artikelname: |
Anti-HMBS Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA006114 |
| Hersteller Artikelnummer: |
HPA006114 |
| Alternativnummer: |
ATA-HPA006114-100,ATA-HPA006114-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
PBGD, PORC, UPS |
| hydroxymethylbilane synthase |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.3 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
3145 |
| UniProt: |
P08397 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
QFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRL |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
HMBS |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes. |
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells. |
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
HPA006114 |
|
|
|
HPA006114 |
|
HPA006114 |