Anti-SP140
Artikelnummer:
ATA-HPA006162
- Bilder (8)
| Artikelname: | Anti-SP140 |
| Artikelnummer: | ATA-HPA006162 |
| Hersteller Artikelnummer: | HPA006162 |
| Alternativnummer: | ATA-HPA006162-100,ATA-HPA006162-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LYSP100-A, LYSP100-B |
| SP140 nuclear body protein |
| Anti-SP140 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 11262 |
| UniProt: | Q13342 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNVCYEHSPLQMNNVNDLEDRPRLLPYGKQENSNACHEMDDIAVPQEALSSSPRCEPGFSSESCEQLALPKAGGGDAEDAPSLLPGGGVSCKLAIQIDEGESEEMPKLLP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SP140 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA006162 antibody. Corresponding SP140 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows strong nuclear positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows strong nuclear positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected. |
|
|
HPA006162-100ul |
|
|
HPA006162-100ul |
|
|
HPA006162-100ul |
Produktgarantie und fachkundiger Support
