Anti-LZTS1
Artikelnummer:
ATA-HPA006294
- Bilder (8)
| Artikelname: | Anti-LZTS1 |
| Artikelnummer: | ATA-HPA006294 |
| Hersteller Artikelnummer: | HPA006294 |
| Alternativnummer: | ATA-HPA006294-100,ATA-HPA006294-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FEZ1 |
| leucine zipper, putative tumor suppressor 1 |
| Anti-LZTS1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.8 mg/ml |
| Isotyp: | IgG |
| NCBI: | 11178 |
| UniProt: | Q9Y250 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LZTS1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line SK-MEL-30 shows localization to plasma membrane. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and LZTS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412145). |
|
|
|
|
|
HPA006294-100ul |
|
|
|
|
|
HPA006294-100ul |
|
|
HPA006294-100ul |
Produktgarantie und fachkundiger Support
