Anti-ALDH4A1
Artikelnummer:
ATA-HPA006401
- Bilder (8)
| Artikelname: | Anti-ALDH4A1 |
| Artikelnummer: | ATA-HPA006401 |
| Hersteller Artikelnummer: | HPA006401 |
| Alternativnummer: | ATA-HPA006401-100,ATA-HPA006401-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ALDH4, P5CDh |
| aldehyde dehydrogenase 4 family, member A1 |
| Anti-ALDH4A1 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 8659 |
| UniProt: | P30038 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ALDH4A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human kidney and pancreas tissues using Anti-ALDH4A1 antibody. Corresponding ALDH4A1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue |
|
|
HPA006401-100ul |
|
|
|
|
|
HPA006401-100ul |
|
|
HPA006401-100ul |
Produktgarantie und fachkundiger Support
