Anti-ACACB
Artikelnummer:
ATA-HPA006554
- Bilder (8)
| Artikelname: | Anti-ACACB |
| Artikelnummer: | ATA-HPA006554 |
| Hersteller Artikelnummer: | HPA006554 |
| Alternativnummer: | ATA-HPA006554-100,ATA-HPA006554-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ACC2, ACCB, HACC275 |
| acetyl-CoA carboxylase beta |
| Anti-ACACB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 32 |
| UniProt: | O00763 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ACACB |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human adipose tissue and cerebral cortex tissues using Anti-ACACB antibody. Corresponding ACACB RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adipose tissue shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Western blot analysis in human adipose tissue tissue. |
|
|
HPA006554-100ul |
|
|
|
|
|
HPA006554-100ul |
|
|
HPA006554-100ul |
Produktgarantie und fachkundiger Support
