Anti-RBM14

Artikelnummer: ATA-HPA006628
Artikelname: Anti-RBM14
Artikelnummer: ATA-HPA006628
Hersteller Artikelnummer: HPA006628
Alternativnummer: ATA-HPA006628-100,ATA-HPA006628-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: COAA, DKFZp779J0927, SIP, SYTIP1
RNA binding motif protein 14
Anti-RBM14
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 10432
UniProt: Q96PK6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYAR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RBM14
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemical staining of human cerebral cortex shows strong nuclear and moderate cytoplasmic positivity in both neuronal cells and glial cells.
Western blot analysis in human cell line MOLT-4.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA006628-100ul
HPA006628-100ul
HPA006628-100ul