Anti-SWAP70
Artikelnummer:
ATA-HPA006810
- Bilder (7)
| Artikelname: | Anti-SWAP70 |
| Artikelnummer: | ATA-HPA006810 |
| Hersteller Artikelnummer: | HPA006810 |
| Alternativnummer: | ATA-HPA006810-100,ATA-HPA006810-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0640, SWAP-70 |
| SWAP switching B-cell complex 70kDa subunit |
| Anti-SWAP70 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23075 |
| UniProt: | Q9UH65 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQAR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SWAP70 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center cells. |
|
|
Western blot analysis in human cell lines A-431 and MCF-7 using Anti-SWAP70 antibody. Corresponding SWAP70 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA006810-100ul |
|
|
HPA006810-100ul |
|
|
HPA006810-100ul |
Produktgarantie und fachkundiger Support
