Anti-SCG3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA006880
Artikelname: Anti-SCG3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA006880
Hersteller Artikelnummer: HPA006880
Alternativnummer: ATA-HPA006880-100,ATA-HPA006880-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ90833, SGIII
secretogranin III
Anti-SCG3
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 29106
UniProt: Q8WXD2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SCG3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and placenta tissues using Anti-SCG3 antibody. Corresponding SCG3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows low expression as expected.
Immunohistochemical staining of human cerebral cortex shows high expression.
Western blot analysis in human cell line SH-SY5Y.
Western blot analysis in control (vector only transfected HEK293T lysate) and SCG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402232).
HPA006880
HPA006880
HPA006880