Anti-ZSCAN29
Artikelnummer:
ATA-HPA007241
- Bilder (8)
| Artikelname: | Anti-ZSCAN29 |
| Artikelnummer: | ATA-HPA007241 |
| Hersteller Artikelnummer: | HPA007241 |
| Alternativnummer: | ATA-HPA007241-100,ATA-HPA007241-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ35867, Zfp690, ZNF690 |
| zinc finger and SCAN domain containing 29 |
| Anti-ZSCAN29 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 146050 |
| UniProt: | Q8IWY8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TSEAEAQKQAEEADEATEEDSDDDEEDTEIPPGAVITRAPVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQGKGNESDCRSGRQWAKTSGEKRGKLTLPEKSLSEVLSQQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ZSCAN29 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human colon, kidney, liver and testis using Anti-ZSCAN29 antibody HPA007241 (A) shows similar protein distribution across tissues to independent antibody HPA011109 (B). |
|
|
Immunohistochemical staining of human colon using Anti-ZSCAN29 antibody HPA007241. |
|
|
Immunohistochemical staining of human kidney using Anti-ZSCAN29 antibody HPA007241. |
|
|
Immunohistochemical staining of human liver using Anti-ZSCAN29 antibody HPA007241. |
|
|
Immunohistochemical staining of human testis using Anti-ZSCAN29 antibody HPA007241. |
|
|
HPA007241-100ul |
|
|
HPA007241-100ul |
|
|
HPA007241-100ul |
Produktgarantie und fachkundiger Support
