Anti-MAP4K1
Artikelnummer:
ATA-HPA007419
- Bilder (8)
| Artikelname: | Anti-MAP4K1 |
| Artikelnummer: | ATA-HPA007419 |
| Hersteller Artikelnummer: | HPA007419 |
| Alternativnummer: | ATA-HPA007419-100,ATA-HPA007419-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HPK1 |
| mitogen-activated protein kinase kinase kinase kinase 1 |
| Anti-MAP4K1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 11184 |
| UniProt: | Q92918 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MAP4K1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA007419 antibody. Corresponding MAP4K1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows positivity in germinal center cells. |
|
|
Immunohistochemical staining of human tonsil shows positivity in germinal center cells. |
|
|
Immunohistochemical staining of human colon shows positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity as expected. |
|
|
HPA007419-100ul |
|
|
HPA007419-100ul |
|
|
HPA007419-100ul |
Produktgarantie und fachkundiger Support
