Anti-BBOX1
Artikelnummer:
ATA-HPA007600
- Bilder (8)
| Artikelname: | Anti-BBOX1 |
| Artikelnummer: | ATA-HPA007600 |
| Hersteller Artikelnummer: | HPA007600 |
| Alternativnummer: | ATA-HPA007600-100,ATA-HPA007600-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BBH, BBOX, G-BBH, gamma-BBH |
| butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1 |
| Anti-BBOX1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8424 |
| UniProt: | O75936 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKLT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BBOX1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-BBOX1 antibody. Corresponding BBOX1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue. |
|
|
HPA007600-100ul |
|
|
|
|
|
HPA007600-100ul |
|
|
HPA007600-100ul |
Produktgarantie und fachkundiger Support
