Anti-RIOX2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA007603
Artikelname: Anti-RIOX2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA007603
Hersteller Artikelnummer: HPA007603
Alternativnummer: ATA-HPA007603-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ14393, JMJD10, mdig, MINA, MINA53, NO52
ribosomal oxygenase 2
Anti-RIOX2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 84864
UniProt: Q8IUF8
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDDPALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELW
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RIOX2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemical staining of human thyroid gland shows nuclear positivity in glandular cells.
Western blot analysis in human cell lines A-431 and HeLa using Anti-RIOX2 antibody. Corresponding RIOX2 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in control (vector only transfected HEK293T lysate) and MINA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407126).
HPA007603
HPA007603
HPA007603