Anti-KDM4A
Artikelnummer:
ATA-HPA007610
- Bilder (8)
| Artikelname: | Anti-KDM4A |
| Artikelnummer: | ATA-HPA007610 |
| Hersteller Artikelnummer: | HPA007610 |
| Alternativnummer: | ATA-HPA007610-100,ATA-HPA007610-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | JHDM3A, JMJD2, JMJD2A, KIAA0677, TDRD14A |
| lysine (K)-specific demethylase 4A |
| Anti-KDM4A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9682 |
| UniProt: | O75164 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTEC |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KDM4A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts. |
|
|
Western blot analysis in human cell line HEK 293. |
|
|
HPA007610-100ul |
|
|
|
|
|
|
|
|
HPA007610-100ul |
|
|
HPA007610-100ul |
Produktgarantie und fachkundiger Support
