Anti-PRDX1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA007730
Artikelname: Anti-PRDX1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA007730
Hersteller Artikelnummer: HPA007730
Alternativnummer: ATA-HPA007730-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NKEFA, PAGA
peroxiredoxin 1
Anti-PRDX1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5052
UniProt: Q06830
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PRDX1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines PC-3 and SK-MEL-30 using Anti-PRDX1 antibody. Corresponding PRDX1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western blot analysis in human cell line HepG2.
HPA007730
HPA007730
HPA007730