Anti-SFXN3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA008028
Artikelname: Anti-SFXN3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA008028
Hersteller Artikelnummer: HPA008028
Alternativnummer: ATA-HPA008028-100,ATA-HPA008028-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SFX3
sideroflexin 3
Anti-SFXN3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 81855
UniProt: Q9BWM7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SFXN3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human liver shows strong cytoplasmic positivity with granular pattern in hepatocytes.
Western blot analysis in human cell line U-87 MG.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA008028
HPA008028
HPA008028