Anti-SLC6A17
Artikelnummer:
ATA-HPA008044
- Bilder (7)
| Artikelname: | Anti-SLC6A17 |
| Artikelnummer: | ATA-HPA008044 |
| Hersteller Artikelnummer: | HPA008044 |
| Alternativnummer: | ATA-HPA008044-100,ATA-HPA008044-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SLC6A17 |
| solute carrier family 6 (neutral amino acid transporter), member 17 |
| Anti-SLC6A17 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 388662 |
| UniProt: | Q9H1V8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSALGLDPCLLEDELDKSVQGTGLAFIAFTEAMTHFPASPFWSV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC6A17 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-SLC6A17 antibody. Corresponding SLC6A17 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in astrocytes. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA008044-100ul |
|
|
HPA008044-100ul |
|
|
HPA008044-100ul |
Produktgarantie und fachkundiger Support
