Anti-RNF43
Artikelnummer:
ATA-HPA008079
- Bilder (7)
| Artikelname: | Anti-RNF43 |
| Artikelnummer: | ATA-HPA008079 |
| Hersteller Artikelnummer: | HPA008079 |
| Alternativnummer: | ATA-HPA008079-100,ATA-HPA008079-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp781H0392, FLJ20315, URCC |
| ring finger protein 43 |
| Anti-RNF43 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 54894 |
| UniProt: | Q68DV7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSHLQSTSQH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RNF43 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human duodenum shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
HPA008079-100ul |
|
|
HPA008079-100ul |
|
|
HPA008079-100ul |
Produktgarantie und fachkundiger Support
