Anti-PRKAR2B
Artikelnummer:
ATA-HPA008421
- Bilder (8)
| Artikelname: | Anti-PRKAR2B |
| Artikelnummer: | ATA-HPA008421 |
| Hersteller Artikelnummer: | HPA008421 |
| Alternativnummer: | ATA-HPA008421-100,ATA-HPA008421-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PRKAR2 |
| protein kinase, cAMP-dependent, regulatory, type II, beta |
| Anti-PRKAR2B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5577 |
| UniProt: | P31323 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PRKAR2B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human adipose tissue and liver tissues using Anti-PRKAR2B antibody. Corresponding PRKAR2B RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adipose tissue shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Western blot analysis in human cell line Daudi. |
|
|
HPA008421-100ul |
|
|
|
|
|
HPA008421-100ul |
|
|
HPA008421-100ul |
Produktgarantie und fachkundiger Support
