Anti-PANK2

Artikelnummer: ATA-HPA008440
Artikelname: Anti-PANK2
Artikelnummer: ATA-HPA008440
Hersteller Artikelnummer: HPA008440
Alternativnummer: ATA-HPA008440-100,ATA-HPA008440-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C20orf48, FLJ11729, HARP, HSS, NBIA1, PKAN
pantothenate kinase 2
Anti-PANK2
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 80025
UniProt: Q9BZ23
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PANK2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human testis shows cytoplasmic positivity in seminiferous ducts.
Western blot analysis in control (vector only transfected HEK293T lysate) and PANK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410958).
HPA008440-100ul
HPA008440-100ul
HPA008440-100ul