Anti-MCL1
Artikelnummer:
ATA-HPA008455
- Bilder (8)
| Artikelname: | Anti-MCL1 |
| Artikelnummer: | ATA-HPA008455 |
| Hersteller Artikelnummer: | HPA008455 |
| Alternativnummer: | ATA-HPA008455-100,ATA-HPA008455-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BCL2L3, Mcl-1 |
| myeloid cell leukemia 1 |
| Anti-MCL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4170 |
| UniProt: | Q07820 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MCL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells. |
|
|
Immunohistochemical staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells. |
|
|
Western blot analysis in human cell line NTERA-2. |
|
|
|
|
|
HPA008455-100ul |
|
|
HPA008455-100ul |
|
|
HPA008455-100ul |
Produktgarantie und fachkundiger Support
