Anti-NME1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA008467
Artikelname: Anti-NME1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA008467
Hersteller Artikelnummer: HPA008467
Alternativnummer: ATA-HPA008467-100,ATA-HPA008467-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NDPKA, NM23, NM23-H1
NME/NM23 nucleoside diphosphate kinase 1
Anti-NME1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 4830
UniProt: P15531
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NME1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
Western blot analysis in human cell line A-549.
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
HPA008467
HPA008467
HPA008467