Anti-SVBP
Artikelnummer:
ATA-HPA008507
- Bilder (7)
| Artikelname: | Anti-SVBP |
| Artikelnummer: | ATA-HPA008507 |
| Hersteller Artikelnummer: | HPA008507 |
| Alternativnummer: | ATA-HPA008507-100,ATA-HPA008507-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CCDC23, MGC45441 |
| small vasohibin binding protein |
| Anti-SVBP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 374969 |
| UniProt: | Q8N300 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SVBP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human placenta shows weak to moderate nuclear positivity in a subset of trophoblastic cells. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts. |
|
|
HPA008507-100ul |
|
|
HPA008507-100ul |
|
|
HPA008507-100ul |
Produktgarantie und fachkundiger Support
