Anti-PEBP1
Artikelnummer:
ATA-HPA008819
- Bilder (8)
| Artikelname: | Anti-PEBP1 |
| Artikelnummer: | ATA-HPA008819 |
| Hersteller Artikelnummer: | HPA008819 |
| Alternativnummer: | ATA-HPA008819-100,ATA-HPA008819-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HCNP, PBP, PEBP, RKIP |
| phosphatidylethanolamine binding protein 1 |
| Anti-PEBP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5037 |
| UniProt: | P30086 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PEBP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human adrenal gland and lymph node tissues using HPA008819 antibody. Corresponding PEBP1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human adrenal gland shows very strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows no positivity in germinal center cells as expected. |
|
|
HPA008819-100ul |
|
|
HPA008819-100ul |
|
|
HPA008819-100ul |
Produktgarantie und fachkundiger Support
