Anti-HSF1
Artikelnummer:
ATA-HPA008888
- Bilder (8)
| Artikelname: | Anti-HSF1 |
| Artikelnummer: | ATA-HPA008888 |
| Hersteller Artikelnummer: | HPA008888 |
| Alternativnummer: | ATA-HPA008888-100,ATA-HPA008888-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HSTF1 |
| heat shock transcription factor 1 |
| Anti-HSF1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3297 |
| UniProt: | Q00613 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HSF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human kidney shows strong nuclear and moderate cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis in human cell line PC-3. |
|
|
HPA008888-100ul |
|
|
|
|
|
|
|
|
HPA008888-100ul |
|
|
HPA008888-100ul |
Produktgarantie und fachkundiger Support
