Anti-SIGLEC6

Artikelnummer: ATA-HPA008945
Artikelname: Anti-SIGLEC6
Artikelnummer: ATA-HPA008945
Hersteller Artikelnummer: HPA008945
Alternativnummer: ATA-HPA008945-100,ATA-HPA008945-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD327, CD33L, CD33L1, OB-BP1, SIGLEC-6
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 946
UniProt: O43699
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Target-Kategorie: SIGLEC6
Antibody Type: Monoclonal Antibody
HPA008945-100ul