Anti-VAPA Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA009174
Artikelname: Anti-VAPA Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA009174
Hersteller Artikelnummer: HPA009174
Alternativnummer: ATA-HPA009174-100,ATA-HPA009174-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: hVAP-33, VAP-A
VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
Anti-VAPA
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 9218
UniProt: Q9P0L0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NDKLGITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: VAPA
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western blot analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VAPA antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis in human cell line MOLT-4.
HPA009174
HPA009174
HPA009174