Anti-LDLR
Artikelnummer:
ATA-HPA009647
- Bilder (7)
| Artikelname: | Anti-LDLR |
| Artikelnummer: | ATA-HPA009647 |
| Hersteller Artikelnummer: | HPA009647 |
| Alternativnummer: | ATA-HPA009647-100,ATA-HPA009647-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LDLCQ2 |
| low density lipoprotein receptor |
| Anti-LDLR |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3949 |
| UniProt: | P01130 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LDLR |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human fallopian tube shows no positivity in glandular cells as expected. |
|
|
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages. |
|
|
HPA009647-100ul |
|
|
HPA009647-100ul |
|
|
HPA009647-100ul |
Produktgarantie und fachkundiger Support
