Anti-RMDN3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA009975
| Artikelname: |
Anti-RMDN3 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA009975 |
| Hersteller Artikelnummer: |
HPA009975 |
| Alternativnummer: |
ATA-HPA009975-100,ATA-HPA009975-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ICC, IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3 |
| regulator of microtubule dynamics 3 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.2 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
55177 |
| UniProt: |
Q96TC7 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
DEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCG |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
RMDN3 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria. |
|
Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes. |
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts. |
|
Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes. |
|
Western blot analysis in human cell line CACO-2. |
|
|
|
HPA009975 |
|
|
|
HPA009975 |
|
HPA009975 |