Anti-COL6A3
Artikelnummer:
ATA-HPA010080
- Bilder (8)
| Artikelname: | Anti-COL6A3 |
| Artikelnummer: | ATA-HPA010080 |
| Hersteller Artikelnummer: | HPA010080 |
| Alternativnummer: | ATA-HPA010080-100,ATA-HPA010080-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | COL6A3 |
| collagen, type VI, alpha 3 |
| Anti-COL6A3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1293 |
| UniProt: | P12111 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | COL6A3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human ovary shows moderate cytoplasmic positivity in connective tissues. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in connective tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons. |
|
|
Western blot analysis in human cell line U-87 MG. |
|
|
HPA010080-100ul |
|
|
|
|
|
HPA010080-100ul |
|
|
HPA010080-100ul |
Produktgarantie und fachkundiger Support
