Anti-UPK3B
Artikelnummer:
ATA-HPA010506
- Bilder (7)
| Artikelname: | Anti-UPK3B |
| Artikelnummer: | ATA-HPA010506 |
| Hersteller Artikelnummer: | HPA010506 |
| Alternativnummer: | ATA-HPA010506-100,ATA-HPA010506-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ32198, MGC10902, p35, UPIIIb |
| uroplakin 3B |
| Anti-UPK3B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 105375355 |
| UniProt: | Q9BT76 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | UPK3B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & vesicles. |
|
|
Immunohistochemical staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
HPA010506-100ul |
|
|
|
|
|
HPA010506-100ul |
|
|
HPA010506-100ul |
Produktgarantie und fachkundiger Support
