Anti-CLPS

Artikelnummer: ATA-HPA010512
Artikelname: Anti-CLPS
Artikelnummer: ATA-HPA010512
Hersteller Artikelnummer: HPA010512
Alternativnummer: ATA-HPA010512-100,ATA-HPA010512-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CLPS
colipase, pancreatic
Anti-CLPS
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 1208
UniProt: P04118
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CLPS
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human pancreas and liver tissues using Anti-CLPS antibody. Corresponding CLPS RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human pancreas shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and CLPS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419722).
HPA010512-100ul
HPA010512-100ul
HPA010512-100ul