Anti-PSTPIP1

Artikelnummer: ATA-HPA010600
Artikelname: Anti-PSTPIP1
Artikelnummer: ATA-HPA010600
Hersteller Artikelnummer: HPA010600
Alternativnummer: ATA-HPA010600-100,ATA-HPA010600-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD2BP1, CD2BP1L, CD2BP1S, H-PIP, PAPAS, PSTPIP
proline-serine-threonine phosphatase interacting protein 1
Anti-PSTPIP1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 9051
UniProt: O43586
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GMIKRFSGLLHGSPKTTSLAASAASTETLTPTPERNEGVYTAIAVQEIQGNPASPAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PSTPIP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-PSTPIP1 antibody. Corresponding PSTPIP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA010600-100ul
HPA010600-100ul
HPA010600-100ul