Anti-CYB5R1
Artikelnummer:
ATA-HPA010641
- Bilder (8)
| Artikelname: | Anti-CYB5R1 |
| Artikelnummer: | ATA-HPA010641 |
| Hersteller Artikelnummer: | HPA010641 |
| Alternativnummer: | ATA-HPA010641-100,ATA-HPA010641-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | humb5R2, NQO3A2 |
| cytochrome b5 reductase 1 |
| Anti-CYB5R1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51706 |
| UniProt: | Q9UHQ9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CYB5R1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, pancreas and testis using Anti-CYB5R1 antibody HPA010641 (A) shows similar protein distribution across tissues to independent antibody HPA014147 (B). |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-CYB5R1 antibody HPA010641. |
|
|
Immunohistochemical staining of human kidney using Anti-CYB5R1 antibody HPA010641. |
|
|
Immunohistochemical staining of human testis using Anti-CYB5R1 antibody HPA010641. |
|
|
Immunohistochemical staining of human pancreas using Anti-CYB5R1 antibody HPA010641. |
|
|
HPA010641-100ul |
|
|
HPA010641-100ul |
|
|
HPA010641-100ul |
Produktgarantie und fachkundiger Support
