Anti-FXYD5

Artikelnummer: ATA-HPA010817
Artikelname: Anti-FXYD5
Artikelnummer: ATA-HPA010817
Hersteller Artikelnummer: HPA010817
Alternativnummer: ATA-HPA010817-100,ATA-HPA010817-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: OIT2
FXYD domain containing ion transport regulator 5
Anti-FXYD5
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 53827
UniProt: Q96DB9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FXYD5
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-FXYD5 antibody. Corresponding FXYD5 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Western blot analysis in control (vector only transfected HEK293T lysate) and FXYD5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402284).
HPA010817-100ul
HPA010817-100ul
HPA010817-100ul