Anti-SFTPC
Artikelnummer:
ATA-HPA010928
- Bilder (8)
| Artikelname: | Anti-SFTPC |
| Artikelnummer: | ATA-HPA010928 |
| Hersteller Artikelnummer: | HPA010928 |
| Alternativnummer: | ATA-HPA010928-100,ATA-HPA010928-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BRICD6, PSP-C, SFTP2, SMDP2, SP-C |
| surfactant protein C |
| Anti-SFTPC |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6440 |
| UniProt: | P11686 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SFTPC |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human lung and kidney tissues using HPA010928 antibody. Corresponding SFTPC RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in respiratory epithelial cells. |
|
|
Immunohistochemical staining of human kidney shows no positivity in cells in glomeruli as expected. |
|
|
Western blot analysis in human lung tissue. |
|
|
HPA010928-100ul |
|
|
|
|
|
HPA010928-100ul |
|
|
HPA010928-100ul |
Produktgarantie und fachkundiger Support
