Anti-CDC5L

Artikelnummer: ATA-HPA011361
Artikelname: Anti-CDC5L
Artikelnummer: ATA-HPA011361
Hersteller Artikelnummer: HPA011361
Alternativnummer: ATA-HPA011361-100,ATA-HPA011361-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CDC5, CEF1, hCDC5, PCDC5RP
cell division cycle 5-like
Anti-CDC5L
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 988
UniProt: Q99459
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CDC5L
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA011361-100ul
HPA011361-100ul
HPA011361-100ul