Anti-HDAC2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA011727
Artikelname: Anti-HDAC2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA011727
Hersteller Artikelnummer: HPA011727
Alternativnummer: ATA-HPA011727-100,ATA-HPA011727-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: RPD3, YAF1
histone deacetylase 2
Anti-HDAC2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 3066
UniProt: Q92769
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HDAC2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HDAC2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA011727
HPA011727
HPA011727