Anti-GALNT6

Artikelnummer: ATA-HPA011762
Artikelname: Anti-GALNT6
Artikelnummer: ATA-HPA011762
Hersteller Artikelnummer: HPA011762
Alternativnummer: ATA-HPA011762-100,ATA-HPA011762-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GalNAc-T6
polypeptide N-acetylgalactosaminyltransferase 6
Anti-GALNT6
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 11226
UniProt: Q8NCL4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GALNT6
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human stomach and liver tissues using Anti-GALNT6 antibody. Corresponding GALNT6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human stomach shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-GALNT6 antibody. Corresponding GALNT6 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Western blot analysis in control (vector only transfected HEK293T lysate) and GALNT6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416125).
HPA011762-100ul
HPA011762-100ul
HPA011762-100ul