Anti-DKK3

Artikelnummer: ATA-HPA011868
Artikelname: Anti-DKK3
Artikelnummer: ATA-HPA011868
Hersteller Artikelnummer: HPA011868
Alternativnummer: ATA-HPA011868-100,ATA-HPA011868-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: REIC, RIG
dickkopf WNT signaling pathway inhibitor 3
Anti-DKK3
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 27122
UniProt: Q9UBP4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: CGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYLAASW
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DKK3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and DKK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415712).
HPA011868-100ul
HPA011868-100ul
HPA011868-100ul