Anti-C1orf116
Artikelnummer:
ATA-HPA011889
- Bilder (8)
| Artikelname: | Anti-C1orf116 |
| Artikelnummer: | ATA-HPA011889 |
| Hersteller Artikelnummer: | HPA011889 |
| Alternativnummer: | ATA-HPA011889-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ36507, MGC2742, MGC4309, SARG |
| chromosome 1 open reading frame 116 |
| Anti-C1orf116 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 79098 |
| UniProt: | Q9BW04 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SGEDPNSRLAPLTTPKPRKLPPNIVLKSSRSSFHSDPQHWLSRHTEAAPGDSGLISCSLQEQRKARKEALEKLGLPQDQDEPGLHLSKPTSSIRPKETRAQHLSPAPGLAQPAAPAQASAAIPAAG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | C1orf116 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human stomach and liver tissues using Anti-C1orf116 antibody. Corresponding C1orf116 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human stomach shows high expression. |
|
|
Western blot analysis using Anti-C1orf116 antibody HPA011889 (A) shows similar pattern to independent antibody HPA011888 (B). |
|
|
HPA011889-100ul |
|
|
|
|
|
HPA011889-100ul |
|
|
HPA011889-100ul |
Produktgarantie und fachkundiger Support
