Anti-DNAJC4

Artikelnummer: ATA-HPA011947
Artikelname: Anti-DNAJC4
Artikelnummer: ATA-HPA011947
Hersteller Artikelnummer: HPA011947
Alternativnummer: ATA-HPA011947-100,ATA-HPA011947-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HSPF2, MCG18
DnaJ (Hsp40) homolog, subfamily C, member 4
Anti-DNAJC4
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 3338
UniProt: Q9NNZ3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRPQGPQLRQQQHKQNKQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJC4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.
HPA011947-100ul