Anti-MGLL
Artikelnummer:
ATA-HPA011994
- Bilder (7)
| Artikelname: | Anti-MGLL |
| Artikelnummer: | ATA-HPA011994 |
| Hersteller Artikelnummer: | HPA011994 |
| Alternativnummer: | ATA-HPA011994-100,ATA-HPA011994-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HU-K5, MGL |
| monoglyceride lipase |
| Anti-MGLL |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 11343 |
| UniProt: | Q99685 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RQHIMETGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSM |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MGLL |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human kidney shows cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human colon shows cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells. |
|
|
HPA011994-100ul |
|
|
HPA011994-100ul |
|
|
HPA011994-100ul |
Produktgarantie und fachkundiger Support
