Anti-PARN Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA012010
Artikelname: Anti-PARN Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA012010
Hersteller Artikelnummer: HPA012010
Alternativnummer: ATA-HPA012010-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DAN
poly(A)-specific ribonuclease
Anti-PARN
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5073
UniProt: O95453
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKVESAEGFPSYD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PARN
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-PARN antibody. Corresponding PARN RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis using Anti-PARN antibody HPA012010 (A) shows similar pattern to independent antibody HPA006314 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA012010
HPA012010
HPA012010