Anti-ARHGEF11
Artikelnummer:
ATA-HPA012037
- Bilder (8)
| Artikelname: | Anti-ARHGEF11 |
| Artikelnummer: | ATA-HPA012037 |
| Hersteller Artikelnummer: | HPA012037 |
| Alternativnummer: | ATA-HPA012037-100,ATA-HPA012037-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GTRAP48, KIAA0380, PDZ-RHOGEF |
| Rho guanine nucleotide exchange factor (GEF) 11 |
| Anti-ARHGEF11 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9826 |
| UniProt: | O15085 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PGHTMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGGEGDNTQLAGLEGERPEQEDMGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGYKVVRKAEVAGSKVVPALP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ARHGEF11 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-ARHGEF11 antibody HPA012037 (A) shows similar protein distribution across tissues to independent antibody HPA011026 (B). |
|
|
Immunohistochemical staining of human testis using Anti-ARHGEF11 antibody HPA012037. |
|
|
Immunohistochemical staining of human lymph node using Anti-ARHGEF11 antibody HPA012037. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-ARHGEF11 antibody HPA012037. |
|
|
Immunohistochemical staining of human colon using Anti-ARHGEF11 antibody HPA012037. |
|
|
HPA012037-100ul |
|
|
HPA012037-100ul |
|
|
HPA012037-100ul |
Produktgarantie und fachkundiger Support
