Anti-CSF1R Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA012323
Artikelname: Anti-CSF1R Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA012323
Hersteller Artikelnummer: HPA012323
Alternativnummer: ATA-HPA012323-100,ATA-HPA012323-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C-FMS, CD115, CSFR, FMS
colony stimulating factor 1 receptor
Anti-CSF1R
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 1436
UniProt: P07333
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CSF1R
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & vesicles.
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in non - germinal center cells.
Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Western blot analysis in human cell line BEWO.
Western blot analysis in control (vector only transfected HEK293T lysate) and CSF1R over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401594).
HPA012323
HPA012323
HPA012323