Anti-PTPN1
Artikelnummer:
ATA-HPA012542
- Bilder (8)
| Artikelname: | Anti-PTPN1 |
| Artikelnummer: | ATA-HPA012542 |
| Hersteller Artikelnummer: | HPA012542 |
| Alternativnummer: | ATA-HPA012542-100,ATA-HPA012542-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PTP1B |
| protein tyrosine phosphatase, non-receptor type 1 |
| Anti-PTPN1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5770 |
| UniProt: | P18031 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYW |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PTPN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows positivity in endoplasmic reticulum. |
|
|
Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells. |
|
|
Western blot analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PTPN1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
HPA012542-100ul |
|
|
|
|
|
|
|
|
HPA012542-100ul |
|
|
HPA012542-100ul |
Produktgarantie und fachkundiger Support
