Anti-CDHR2
Artikelnummer:
ATA-HPA012569
- Bilder (7)
| Artikelname: | Anti-CDHR2 |
| Artikelnummer: | ATA-HPA012569 |
| Hersteller Artikelnummer: | HPA012569 |
| Alternativnummer: | ATA-HPA012569-100,ATA-HPA012569-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ20124, FLJ20383, PC-LKC, PCDH24, PCLKC |
| cadherin-related family member 2 |
| Anti-CDHR2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54825 |
| UniProt: | Q9BYE9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFTVDQSYRSRLQFSTPKEEVGANRQAINAALTQATRTTVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLTQLLQLGLVVLGSQESQESDLSKQLISV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CDHR2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human small intestine shows positivity in apical membrane in glandular cells. |
|
|
Immunohistochemical staining of human liver shows moderate to strong membranous positivity in hepatocytes. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in cells in tubules. |
|
|
Immunohistochemical staining of human tonsil shows no membranous positivity as expected. |
|
|
HPA012569-100ul |
|
|
HPA012569-100ul |
|
|
HPA012569-100ul |
Produktgarantie und fachkundiger Support
